Loading...
Statistics
Advertisement

Home
www.brucecrossingarea.com/
events around the Bruce crossing area. Area Businesses in Bruce Crossing area.

Brucecrossingarea.com

Advertisement
Brucecrossingarea.com is hosted in United States / Boydton . Brucecrossingarea.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Iframe, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.5. Its CMS is: DotNetNuke.

Technologies in use by Brucecrossingarea.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 0

Content Management System

Number of occurences: 1
  • DotNetNuke

Server Type

  • Microsoft-IIS/8.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Brucecrossingarea.com

SSL certificate

    • name: /C=US/ST=WA/L=Redmond/O=Microsoft Corporation/OU=Microsoft Corporation/CN=*.sharepoint.com
    • subject:
      • C: US
      • ST: WA
      • L: Redmond
      • O: Microsoft Corporation
      • OU: Microsoft Corporation
      • CN: *.sharepoint.com
    • hash: 8debd522
    • issuer:
      • C: US
      • ST: Washington
      • L: Redmond
      • O: Microsoft Corporation
      • OU: Microsoft IT
      • CN: Microsoft IT SSL SHA2
    • version: 2
    • serialNumber: 2007068020623610013714833438075590504788184262
    • validFrom: 160223194210Z
    • validTo: 180222194210Z
    • validFrom_time_t: 1456256530
    • validTo_time_t: 1519328530
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment, Data Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectKeyIdentifier: C8:A4:6D:CC:7A:17:86:03:C9:92:E3:09:12:1F:28:EF:AD:13:47:C9
      • subjectAltName: DNS:*.sharepoint.com, DNS:*.sharepoint.apac.microsoftonline.com, DNS:*.sharepoint.emea.microsoftonline.com, DNS:*.sharepoint.microsoftonline.com
      • authorityKeyIdentifier: keyid:51:AF:24:26:9C:F4:68:22:57:80:26:2B:3B:46:62:15:7B:1E:CC:A5
      • crlDistributionPoints: Full Name: URI:http://mscrl.microsoft.com/pki/mscorp/crl/msitwww2.crl URI:http://crl.microsoft.com/pki/mscorp/crl/msitwww2.crl
      • authorityInfoAccess: CA Issuers - URI:http://www.microsoft.com/pki/mscorp/msitwww2.crt OCSP - URI:http://ocsp.msocsp.com
      • certificatePolicies: Policy: 1.3.6.1.4.1.311.42.1 CPS: http://www.microsoft.com/pki/mscorp/cps
      • 1.3.6.1.4.1.311.21.10: 00 +0 +

Meta - Brucecrossingarea.com

Number of occurences: 2
  • Name: Keywords
    Content: Bruce Crossing Area, Bruce Crossing, Birthday Boards, Simply Yours Soaps and Candle Co. Craft shows
  • Name: Description
    Content: events around the Bruce crossing area. Area Businesses in Bruce Crossing area.

Server / Hosting

  • IP: 104.146.186.29
  • Latitude: 36.66
  • Longitude: -78.37
  • Country: United States
  • City: Boydton

Rname

  • ns4.bdm.microsoftonline.com
  • ns1.bdm.microsoftonline.com
  • ns2.bdm.microsoftonline.com
  • ns3.bdm.microsoftonline.com
  • brucecrossingarea-com.mail.eo.outlook.com

Target

  • msnhst.microsoft.com

HTTP Header Response

HTTP/1.1 302 Found Content-Type: text/html; charset=UTF-8 Location: http://www.brucecrossingarea.com/Pages/default.aspx Server: Microsoft-IIS/8.5 X-SharePointHealthScore: 0 SPRequestGuid: f9ff9e9d-b099-3000-9f43-0892de831b24 request-id: f9ff9e9d-b099-3000-9f43-0892de831b24 X-FRAME-OPTIONS: SAMEORIGIN SPRequestDuration: 23 SPIisLatency: 1 X-Powered-By: ASP.NET MicrosoftSharePointTeamServices: 16.0.0.5618 X-Content-Type-Options: nosniff X-MS-InvokeApp: 1; RequireReadOnly P3P: CP="ALL IND DSP COR ADM CONo CUR CUSo IVAo IVDo PSA PSD TAI TELo OUR SAMo CNT COM INT NAV ONL PHY PRE PUR UNI" Date: Tue, 30 Aug 2016 23:39:51 GMT Content-Length: 174 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Cache-Control: private, max-age=0 Content-Type: text/html; charset=utf-8 Expires: Mon, 15 Aug 2016 23:39:52 GMT Last-Modified: Tue, 30 Aug 2016 23:39:52 GMT Server: Microsoft-IIS/8.5 X-SharePointHealthScore: 0 X-UA-Compatible: IE=EmulateIE8 X-AspNet-Version: 4.0.30319 SPRequestGuid: f9ff9e9d-60a6-3000-9f43-09e9b05b2ff8 request-id: f9ff9e9d-60a6-3000-9f43-09e9b05b2ff8 X-FRAME-OPTIONS: SAMEORIGIN SPRequestDuration: 385 SPIisLatency: 4 X-Powered-By: ASP.NET MicrosoftSharePointTeamServices: 16.0.0.5618 X-Content-Type-Options: nosniff X-MS-InvokeApp: 1; RequireReadOnly P3P: CP="ALL IND DSP COR ADM CONo CUR CUSo IVAo IVDo PSA PSD TAI TELo OUR SAMo CNT COM INT NAV ONL PHY PRE PUR UNI" Date: Tue, 30 Aug 2016 23:39:51 GMT Content-Length: 25511 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: brucecrossingarea.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 104.146.186.29
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4.bdm.microsoftonline.com
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bdm.microsoftonline.com
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bdm.microsoftonline.com
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.bdm.microsoftonline.com
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns1.bdm.microsoftonline.com
  5. rname: msnhst.microsoft.com
  6. serial: 2007070100
  7. refresh: 10800
  8. retry: 1800
  9. expire: 691200
  10. minimum-ttl: 3600
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: brucecrossingarea-com.mail.eo.outlook.com
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 include:outlook.com ~all
  5. entries: Array
host: brucecrossingarea.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: mscid=xE4lKEJx7pN7hfsBI0P47Cq5QSANl8vxBQjd6ap4dBk/I27e4cTkwptvep8Fqw3qB9AYKrR2PdUSrtQqN9WjLg==
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rucecrossingarea.com, www.bqrucecrossingarea.com, www.qrucecrossingarea.com, www.bwrucecrossingarea.com, www.wrucecrossingarea.com, www.bzrucecrossingarea.com, www.zrucecrossingarea.com, www.bxrucecrossingarea.com, www.xrucecrossingarea.com, www.brucecrossingarea.com, www.rucecrossingarea.com, www.bsrucecrossingarea.com, www.srucecrossingarea.com, www.byrucecrossingarea.com, www.yrucecrossingarea.com, www.berucecrossingarea.com, www.erucecrossingarea.com, www.bdrucecrossingarea.com, www.drucecrossingarea.com, www.bcrucecrossingarea.com, www.crucecrossingarea.com, www.bucecrossingarea.com, www.briucecrossingarea.com, www.biucecrossingarea.com, www.broucecrossingarea.com, www.boucecrossingarea.com, www.brlucecrossingarea.com, www.blucecrossingarea.com, www.brlucecrossingarea.com, www.blucecrossingarea.com, www.br.ucecrossingarea.com, www.b.ucecrossingarea.com, www.brcecrossingarea.com, www.bruwcecrossingarea.com, www.brwcecrossingarea.com, www.bruececrossingarea.com, www.brececrossingarea.com, www.bruscecrossingarea.com, www.brscecrossingarea.com, www.bruacecrossingarea.com, www.bracecrossingarea.com, www.bruecrossingarea.com, www.brucdecrossingarea.com, www.brudecrossingarea.com, www.brucrecrossingarea.com, www.brurecrossingarea.com, www.bructecrossingarea.com, www.brutecrossingarea.com, www.brucvecrossingarea.com, www.bruvecrossingarea.com, www.brucfecrossingarea.com, www.brufecrossingarea.com, www.brucgecrossingarea.com, www.brugecrossingarea.com, www.bruchecrossingarea.com, www.bruhecrossingarea.com, www.brucnecrossingarea.com, www.brunecrossingarea.com, www.brucmecrossingarea.com, www.brumecrossingarea.com, www.brucjecrossingarea.com, www.brujecrossingarea.com, www.bruccrossingarea.com, www.brucexcrossingarea.com, www.brucxcrossingarea.com, www.brucescrossingarea.com, www.brucscrossingarea.com, www.brucewcrossingarea.com, www.brucwcrossingarea.com, www.brucercrossingarea.com, www.brucrcrossingarea.com, www.brucefcrossingarea.com, www.brucfcrossingarea.com, www.brucevcrossingarea.com, www.brucvcrossingarea.com, www.bruceccrossingarea.com, www.brucccrossingarea.com, www.bruceqcrossingarea.com, www.brucqcrossingarea.com, www.bruceacrossingarea.com, www.brucacrossingarea.com, www.bruceycrossingarea.com, www.brucycrossingarea.com, www.brucerossingarea.com, www.brucecdrossingarea.com, www.brucedrossingarea.com, www.brucecrrossingarea.com, www.brucerrossingarea.com, www.brucectrossingarea.com, www.brucetrossingarea.com, www.brucecvrossingarea.com, www.brucevrossingarea.com, www.brucecfrossingarea.com, www.brucefrossingarea.com, www.brucecgrossingarea.com, www.brucegrossingarea.com, www.brucechrossingarea.com, www.brucehrossingarea.com, www.brucecnrossingarea.com, www.brucenrossingarea.com, www.brucecmrossingarea.com, www.brucemrossingarea.com, www.brucecjrossingarea.com, www.brucejrossingarea.com, www.brucecossingarea.com, www.brucecriossingarea.com, www.bruceciossingarea.com, www.brucecroossingarea.com, www.brucecoossingarea.com, www.brucecrlossingarea.com, www.bruceclossingarea.com, www.brucecrlossingarea.com, www.bruceclossingarea.com, www.brucecr.ossingarea.com, www.brucec.ossingarea.com, www.brucecrssingarea.com, www.brucecrobssingarea.com, www.brucecrbssingarea.com, www.brucecrohssingarea.com, www.brucecrhssingarea.com, www.brucecrogssingarea.com, www.brucecrgssingarea.com, www.brucecrojssingarea.com, www.brucecrjssingarea.com, www.brucecromssingarea.com, www.brucecrmssingarea.com, www.brucecro ssingarea.com, www.brucecr ssingarea.com, www.brucecrovssingarea.com, www.brucecrvssingarea.com, www.brucecrosingarea.com, www.brucecrosesingarea.com, www.brucecroesingarea.com, www.brucecroswsingarea.com, www.brucecrowsingarea.com, www.brucecrosdsingarea.com, www.brucecrodsingarea.com, www.brucecrosxsingarea.com, www.brucecroxsingarea.com, www.brucecrosfsingarea.com, www.brucecrofsingarea.com, www.brucecrosgsingarea.com, www.brucecrogsingarea.com, www.brucecrostsingarea.com, www.brucecrotsingarea.com, www.brucecrosingarea.com, www.brucecrosseingarea.com, www.brucecroseingarea.com, www.brucecrosswingarea.com, www.brucecroswingarea.com, www.brucecrossdingarea.com, www.brucecrosdingarea.com, www.brucecrossxingarea.com, www.brucecrosxingarea.com, www.brucecrossfingarea.com, www.brucecrosfingarea.com, www.brucecrossgingarea.com, www.brucecrosgingarea.com, www.brucecrosstingarea.com, www.brucecrostingarea.com, www.brucecrossngarea.com, www.brucecrossirngarea.com, www.brucecrossrngarea.com, www.brucecrossifngarea.com, www.brucecrossfngarea.com, www.brucecrossivngarea.com, www.brucecrossvngarea.com, www.brucecrossikngarea.com, www.brucecrosskngarea.com, www.brucecrossi,ngarea.com, www.brucecross,ngarea.com, www.brucecrossibngarea.com, www.brucecrossbngarea.com, www.brucecrossigngarea.com, www.brucecrossgngarea.com, www.brucecrossitngarea.com, www.brucecrosstngarea.com, www.brucecrossiyngarea.com, www.brucecrossyngarea.com, www.brucecrossiungarea.com, www.brucecrossungarea.com, www.brucecrossijngarea.com, www.brucecrossjngarea.com, www.brucecrossimngarea.com, www.brucecrossmngarea.com, www.brucecrossinngarea.com, www.brucecrossnngarea.com,

Other websites we recently analyzed

  1. Grow Your Church & Ministry Online With Portia Chandler
    Grow Your Church Online With Portia Chandler | Social Media Strategist to Churches, Pastors, Ministry Leaders, Gospel Artists, & More. Ministry Online.
    Houston (United States) - 192.185.104.23
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Pingback, Schema.org, Wordpress
    Number of Javascript: 2
    Number of meta tags: 12
  2. Contao Praxisbuch-Die Website zum Buch
    Contao: Das umfassende Praxisbuch von Anne-Kathrin Merz
    Germany - 217.160.223.66
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  3. win win lening
    London (United Kingdom) - 89.187.86.129
    Server software: Apache/2.4.7 (Ubuntu)
    Technology: CSS, Html, Php
    Number of meta tags: 3
  4. Carina Verhulst Persoonlijk Leiderschap & Organisatieontwikkeling
    Netherlands - 217.21.241.234
    Server software: squid/3.5.19
    Technology: Html, Php
  5. Myke Walker's Website
    Lake Mary (United States) - 208.94.116.143
    Server software: Apache
    Technology: CSS, Fancybox, Html, Javascript, jQuery Fancybox, Php
    Number of Javascript: 10
    Number of meta tags: 4
  6. Riccione mare.it: i nostri Hotel fronte mare nel centro di Riccione per vacanze e weekend sulla spiaggia
    Riccione Mare è il portale per le Sue vacanze ed i Suoi weekend a Riccione: presenta hotel di Riccione 3 e 4 stelle sul mare e nel centro a Riccione, ed i servizi di ospitalità del Gruppo Atlantic
    Italy - 217.70.144.128
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 PHP/5.4.31
    Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box
    Number of Javascript: 1
    Number of meta tags: 3
  7. resideceondablu.es
    France - 94.23.200.8
    Server software: nginx
    Technology: Html
    Number of meta tags: 1
  8. Stile Grafico - Lissone - Monza
    Stile Grafico da oltre 20 anni opera nella provincia di Monza nel settore della comunicazione grafica visiva con professionalità e riconosciuta esperienza.
    Milan (Italy) - 212.48.12.143
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
    Number of Javascript: 39
    Number of meta tags: 5
  9. karton22.ru
    Russian Federation - 82.146.43.141
    Server software: Apache/2.4.10 (Debian)
    Technology: Html
  10. electricknifesharpenerreviews.com
    Frankfurt (Germany) - 149.126.77.93
    Server software:
    Technology: Html, Iframe, Incapsula, Javascript
    Number of Javascript: 1
    Number of meta tags: 4

Check Other Websites